Zu "GeneID 29799" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZBED2
Anti-ZBED2

Artikelnummer: 600-401-GA9

Anti-ZBED2 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to have no cross-reactivity to ZBED1 or ZBED3. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
Schlagworte: Anti-YPEL1, Anti-FKSG3, Anti-Protein yippee-like 1
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
684,00 €
Bewerten
Anti-YPEL1
Anti-YPEL1

Artikelnummer: G-PACO31124.50

YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
Schlagworte: Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
363,00 €
Bewerten
YPEL1, Human, Real Time PCR Primer Set
YPEL1, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-10079

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: FKSG3, YPEL1, Protein yippee-like 1
Anwendung: RNA quantification
43,00 €
Bewerten
YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein Yippee-like 1)
YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein...

Artikelnummer: 375894.100

Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability:...
Schlagworte: FKSG3, YPEL1, Protein yippee-like 1
MW: 29,6
ab 511,00 €
Bewerten
Anti-YPEL1
Anti-YPEL1

Artikelnummer: G-PACO13280.50

YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt...
Schlagworte: Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
491,00 €
Bewerten